171550
β-Amyloid Precursor Protein, CTF-57, Synthetic
C57, APP714-770, TVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
For general questions please contact our Customer Service:
EMD Chemicals, Inc.
480 S. Democrat Road
08027 Gibbstown
United States
Phone: 800 854 3417
Fax: 800 776 0999
E-mail: Customer.CareDesk@emdchemicals.com
13 February 2012
loading
A 57-amino acid peptide resulting from the γ-secretase cleavage of the C-terminus of β-amyloid precursor protein (APP) at Ala713-Thr714. Represents CTFγ fragment naturally generated in conjunction with Aβ42.
| Product information | |||
|---|---|---|---|
| Peptide Sequence | H-Thr-Val-Ile-Val-Ile-Thr-Leu-Val-Met-Leu-Lys-Lys-Lys-Gln-Tyr-Thr-Ser-Ile-His-His-Gly-Val-Val-Glu-Val-Asp-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH | ||
| Form | White solid | ||
| Formulation | Supplied as a trifluoroacetate salt. | ||
| Molar mass | 6650.7 | ||
| Protect from Light | Yes | ||
| Hygrocopic | Yes | ||
| Packaged under inert gas | Yes | ||
| Purity | ≥95% by HPLC | ||
| Solubility | DMSO | ||
| Chemical formula | C297H469N79O88S3 | ||
| Store and ship information | |||
|---|---|---|---|
| Storage | -20°C | ||
| Ship |
Blue Ice Only
Standard Handling |
||
